DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon66Cii

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster


Alignment Length:242 Identity:60/242 - (24%)
Similarity:94/242 - (38%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNI-- 106
            ||..:.|:.   ||:...|.  ..|.|.:|....|:||.||:...:|.::|   ||.:..:|.  
  Fly    46 AEEGKAPYT---VGLGFSGG--WWCGGSIIAHDWVLTAEHCIGDADSVTVY---FGATWRTNAQF 102

  Fly   107 -------NLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKL 164
                   |.:           :....|:|:|.: ..|.|..:|..:.|||.::..   ...|...
  Fly   103 THWVGNGNFI-----------KHSSADIALIRI-PHVDFWHMVNKVELPSYNDRY---NDYNEWW 152

  Fly   165 IVAGLEGPSFDRR--HSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALT 227
            .||...|.::|..  ....|.:|.:|      |.:.||........:.::|   .|:|...|...
  Fly   153 AVACGWGGTYDGSPLPDYLQCVDLQI------IHNSECSGYYGSVGDNILC---VRTPDGKSTCG 208

  Fly   228 EASGTPRQFH----LLGI----AVAGFFSSDLDHQGYLNIRPHLDWI 266
            ..||.|...|    |:|:    :|||..|.  ...|:..:..|||||
  Fly   209 GDSGGPLVTHDGTKLVGVTNFGSVAGCQSG--APAGFQRVTYHLDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/132 (23%)
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 58/240 (24%)
Tryp_SPc 40..256 CDD:238113 60/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.