DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:280 Identity:64/280 - (22%)
Similarity:100/280 - (35%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDG----------------SNTLL 67
            ||.|.:|.      :...|.|   :..|.:...|.:|.|...:|                |....
  Fly     6 TILALAVA------SASAYES---VVHPKDLSKVAKIEGRITNGYPAEEGKAPYTVGLGFSGGWW 61

  Fly    68 CTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAV-----TVHPDYSPRKFENDL 127
            |.|.:|.:..|:||.||:..| :.::|   ||.:..:|......|     ..|.       ..|:
  Fly    62 CGGSIISNEWVLTAEHCIGGD-AVTVY---FGATWRTNAQFTHWVGSGNFITHG-------SADI 115

  Fly   128 AIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRR--HSATQRLDKRIKM 190
            |:|.: ..|.|..:|..:.|||.::..   ...|....||...|.::|..  ....|.:|.:|  
  Fly   116 ALIRI-PHVDFWHMVNKVELPSYNDRY---NDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQI-- 174

  Fly   191 TYTKIDSKEC--HEKQARFPEELIC-----GHTERSPLSGSALTEASGTPRQFHLLGIA--VAGF 246
                |.:.||  :.......:.:||     |.......||..|....|:    .|:|:.  |:|.
  Fly   175 ----IHNSECASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPLVTHDGS----KLVGVTNWVSGA 231

  Fly   247 FSSDLDHQGYLNIRPHLDWI 266
            ........|:..:..|||||
  Fly   232 GCQAGHPAGFQRVTYHLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 32/144 (22%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 52/239 (22%)
Tryp_SPc 37..254 CDD:238113 54/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.