DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:254 Identity:60/254 - (23%)
Similarity:96/254 - (37%) Gaps:78/254 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI-YGVVF----------GDSD- 102
            |::|.: |.:|:|..| .|.|.:|.:..|:||.||....||.:| ||.::          |.|| 
  Fly    50 PYIVGL-GFSKNGGGT-WCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDF 112

  Fly   103 ----SSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSE----------M 153
                |.:|:|:.  |.|.|                    |..||..:.||...:          :
  Fly   113 IEHGSGDISLIR--TPHVD--------------------FWSLVNKVELPRYDDRYNNYQGWWAL 155

  Fly   154 VPG-SETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTE 217
            |.| .:||:        ||...:..:....::.          ::..|......|..:|||..| 
  Fly   156 VSGWGKTSD--------EGGVSEYLNCVDVQIG----------ENSVCENYYGSFSGDLICIPT- 201

  Fly   218 RSPLSGSALTEASGTPRQFH----LLGIAVAGFFSSDLDH--QGYLNIRPHLDWISKNS 270
              |.:....:..||.|...|    .:||...|..:..|.:  :|.:.:..:||||..|:
  Fly   202 --PENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIRDNT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 37/144 (26%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 57/248 (23%)
Tryp_SPc 41..257 CDD:238113 59/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.