DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:82/242 - (33%) Gaps:71/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVGVTKDGSN--TLLCTGILIDSRRVVTAAHCVSKDESESI-YGVV------FGDSDSSNINLVS 110
            ||.:..|..|  ...|.|.:|....|:|||||.......:| ||.|      |...|:.|::   
  Fly    51 IVALRFDNGNGGGWYCGGSIIGHEWVLTAAHCTYGASYVTISYGAVWRQQPQFTHYDTGNLH--- 112

  Fly   111 AVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVP------------GSETSNSK 163
                          ||:|:|. |..|.|..||..:.||...:...            ||.:.:|.
  Fly   113 --------------NDIALIR-TPHVDFWSLVNKVELPRYDDRYNNFYGWWALLSGWGSSSDSSG 162

  Fly   164 LIVAGLEGPSFDRRHSATQRL---DKRIKMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSA 225
            :                |..|   |.:|......:|....|    ......:|..|   |.:..:
  Fly   163 M----------------TDYLNCVDIQISDNSVCLDYYGSH----YITSNHLCYAT---PENKGS 204

  Fly   226 LTEASGTPRQFH----LLGIAVAGFFSSDLDH--QGYLNIRPHLDWI 266
            .:..||.|...|    .:||...|..:..|.:  :|...:..:||||
  Fly   205 CSGDSGGPLVLHDGNRQVGIVSFGSAAGCLSNSPKGLTRVTGYLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 34/133 (26%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 54/240 (23%)
Tryp_SPc 37..254 CDD:238113 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.