DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:256 Identity:57/256 - (22%)
Similarity:95/256 - (37%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EHPWVVRIVGVTKDGSNTLL--------------------CTGILIDSRRVVTAAHCVSKDESES 92
            |.|.|..|.|....|||..:                    |.|.||.|..|:|||||....:|.:
  Fly    27 EMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVT 91

  Fly    93 IY--GVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVP 155
            :|  ..|...::.::....|.:.:|..::.....||:::|:: .....|..:..:.|||:|.   
  Fly    92 VYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKI-PATSSSSRISAVKLPSISN--- 152

  Fly   156 GSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQAR--FPEELICGHTER 218
            ...|....:.||...|.:.|........|.   .:..|.|.:.:|.:....  ..:..:|..|..
  Fly   153 SYSTFVGDVAVASGWGRTSDTSSGVATNLQ---YVDLTVITNTKCAQTYGTSVVTDSTLCVATTD 214

  Fly   219 SPL-----SGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQGY----LNIRPHLDWISKNS 270
            :..     ||..|...|.:.:      |.:..|.:|....:||    ..:..:||||..|:
  Fly   215 AKSTCNGDSGGPLVLKSSSEQ------IGLTSFGASAGCEKGYPAAFTRVTSYLDWIKTNT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 34/141 (24%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 49/240 (20%)
Tryp_SPc 38..268 CDD:238113 51/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.