DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG10477

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:287 Identity:69/287 - (24%)
Similarity:112/287 - (39%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVT-KDGSNTLLCTGILIDSRR 77
            |.:||...:|....:..|.|..:       |...:.|:.   ||:: |..:.:..|.|.:|.:..
  Fly    23 TPVHPRDSSAVPSIDGRITNGNK-------AAANQFPYQ---VGLSFKSSAGSWWCGGSIIANTW 77

  Fly    78 VVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVT-----VHPDYSPRKFENDLAIIELTKEVV 137
            |:|||||.....|.:||   :|.:..::..|...|:     .|..|:.....||:::|: |..|.
  Fly    78 VLTAAHCTKGASSVTIY---YGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVT 138

  Fly   138 FSDLVQPICLPSVSE----------MVPG-SETSNSKLIVA-GLEGPSFDRRHSATQRLDKRIKM 190
            |:..:..|.||:::.          :..| ..||:|.:.|| .|:...|.               
  Fly   139 FTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQ--------------- 188

  Fly   191 TYTKIDSKECHEKQARFPEE-----LICGHT--ERSPLSGSALTEASGTPRQFHLLGIAVAGFFS 248
               .|.:..|   |..|...     :||..:  ::|...|.     ||.|...:...|.|..|.|
  Fly   189 ---VITNAVC---QKTFGSSVVTSGVICVESINKKSTCQGD-----SGGPLALNNRLIGVTSFVS 242

  Fly   249 SDLDHQ----GYLNIRPHLDWISKNSS 271
            |....:    |:..:..:|||| ||.|
  Fly   243 SKGCEKNAPAGFTRVTSYLDWI-KNQS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 37/141 (26%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 60/264 (23%)
Tryp_SPc 40..267 CDD:238113 63/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.