DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and pik3ip1

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_938188.1 Gene:pik3ip1 / 386643 ZFINID:ZDB-GENE-031030-14 Length:263 Species:Danio rerio


Alignment Length:78 Identity:18/78 - (23%)
Similarity:29/78 - (37%) Gaps:27/78 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 DSKECHEK---QARFPEELI--CGHTER------------SPLSGSALTEASGTPRQFH------ 237
            |.:.|.::   :|..|||.:  .|.|:|            |.:.|:|:....|..:|..      
Zfish    95 DIRICQDQNATEAPAPEESVPTQGLTQRMVETFEPANSFPSQVEGAAVQPVKGVRQQVRSGPKKK 159

  Fly   238 ----LLGIAVAGF 246
                .||..:|.|
Zfish   160 KDLGTLGYVLAVF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450
pik3ip1NP_938188.1 KR 24..101 CDD:214527 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.