DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG15873

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:316 Identity:71/316 - (22%)
Similarity:115/316 - (36%) Gaps:104/316 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KLLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTL--- 66
            ::||..|.: .|..::..|.:|               :|.:.::..:.:.|.|..|..||.|   
  Fly     2 QILTVFLGL-ILSTSLSDADLG---------------VIGDISDETFEMLISGGYKPKSNRLSRH 50

  Fly    67 -----------------LCTGILIDSRRVVTAAHCVSKDESESI----YGVVFGD------SDSS 104
                             .|:|:|:.||.|:|||||::.....|:    ..||||.      .|.|
  Fly    51 VVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDES 115

  Fly   105 NINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDL-VQPICLPSVSEMVPGSET--------- 159
            :...|..:.|||:|...| :|||||:.|::.|..|:. |.|:.:...:.:..|...         
  Fly   116 DFRSVDRLVVHPEYERYK-KNDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIY 179

  Fly   160 -----SNSKLIV-AGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTER 218
                 ||..:.: ..|..||..::|..|...|..:           |.|...   |.:.|.    
  Fly   180 QHGPYSNELVYLDVILRPPSLCQKHYDTFTADHNV-----------CTEPVG---ESMNCA---- 226

  Fly   219 SPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG--------YLNIRPHLDWI 266
            ..:.|..|.:.:    .|.|:|           .|.|        :|:...:.|||
  Fly   227 GDMGGPLLCKGA----LFGLIG-----------GHMGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 43/169 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 60/247 (24%)
Tryp_SPc 59..250 CDD:238113 54/224 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.