DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30414

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:297 Identity:71/297 - (23%)
Similarity:105/297 - (35%) Gaps:82/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRV 78
            ||....|...:.|.:.|:|:               :||:|:::|       ..||.|.||.||.|
  Fly    32 TTKPEFIPMITGGADAGLFS---------------NPWMVKVLG-------EKLCGGSLITSRFV 74

  Fly    79 VTAAHCV-----------------SKDESESI-------------YGVVFGDSD----SSNINLV 109
            :|||||:                 .||.|..:             |...|...|    .|....|
  Fly    75 LTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAV 139

  Fly   110 SAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSF 174
            ....:|.||: ...:||:.::.:...|.:||.|:||||     :|.|....:.   :..:.|...
  Fly   140 DRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICL-----LVEGHMAESP---IFNITGWGV 195

  Fly   175 DRRHSATQRLDKRIKMTYTKIDSKECHEK-QARFPEELICGHTERS---------PLSGSALTEA 229
            ....:.::||.   :.|....|...|..| ..:..|..||.....|         |||.......
  Fly   196 TNDGTPSRRLQ---RATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQVPFAG 257

  Fly   230 SGTPRQFHLLGIAVAGFFSSDLDHQGYLNIRPHLDWI 266
            |....|:.|:....|...|..:    |.|:..|.|||
  Fly   258 SWLTFQYGLVSYGSAACHSFSV----YTNVTHHRDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/157 (25%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 66/286 (23%)
Tryp_SPc 41..290 CDD:238113 66/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.