DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30283

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:284 Identity:70/284 - (24%)
Similarity:114/284 - (40%) Gaps:49/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TFLLTITTLHPTIQAASVGQECGIFNE-----------KQYNSDNIIAEPTEHPWVVRIVGVTKD 61
            |.:..:..|........:|.|.|.|.|           |.....|  |.....||:..::|   :
  Fly     4 TKIFVVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHN--APVASAPWMAMVMG---E 63

  Fly    62 GSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTVHPDYSPRKF-EN 125
            |.  ..|.|.||.:|.|:|:|||::..|.:...||:..::::... .|.|:.||.||   .| ::
  Fly    64 GG--FHCGGTLITNRFVLTSAHCIANGELKVRLGVLEREAEAQKF-AVDAMFVHTDY---YFDQH 122

  Fly   126 DLAIIELTKEVVFSDLVQPICL---PSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKR 187
            |||::.|.|.|.:||.:.||||   |.|..:       :..::.....|.......|:::.|.  
  Fly   123 DLALLRLAKRVHYSDNISPICLLLDPLVKNI-------DEHIVKFRTYGWGKTESRSSSRMLQ-- 178

  Fly   188 IKMTYTKIDSKECHEKQARFPEEL-----ICGHTERSPL----SGSALTEASGTPRQFHLLGIAV 243
             |.:...:...||.:   ::|.:.     ||..:..:..    ||..||..........:....|
  Fly   179 -KTSLFNLHRSECAK---QYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGV 239

  Fly   244 AGFFSSDLDHQG-YLNIRPHLDWI 266
            ..|..:|..... :.|:..|||||
  Fly   240 TSFGHADCSKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 39/127 (31%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 61/244 (25%)
Tryp_SPc 43..266 CDD:238113 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.