DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG10764

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:268 Identity:65/268 - (24%)
Similarity:112/268 - (41%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI 93
            |||....:.:..:..|||.. .|:..|.     .|:...|.|.:|..|.|::||||:.:  ...:
  Fly    30 CGISTRPKISGGDDAAEPNS-IWMAAIF-----NSSDFQCGGTIIHMRFVLSAAHCLVR--GYDL 86

  Fly    94 YGVVFGDSDSSNINLVSA------VTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICL---PS 149
            | |..|   :.|||..:|      |.||.|:...::.||:.:::|::.:|::..|||||:   |:
  Fly    87 Y-VRLG---ARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPA 147

  Fly   150 VSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEK-QARFPEELIC 213
            :...|...:|         .....:..|:.....:.:.|.:.:.|  ..||..| ........||
  Fly   148 LKGSVEKLKT---------FRALGWGNRNGKLSIMLQTIYLLHLK--RNECKRKLNFNLNSRQIC 201

  Fly   214 GHTERSPLSGSALTEASGTPRQFHL-----------LGIAVAGFFSSDLDHQG---YLNIRPHLD 264
            ..|:    :|......||.|...::           |||...|    |.:.:|   |.::..::|
  Fly   202 AGTK----NGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFG----DPECRGVGVYTDVTSYVD 258

  Fly   265 WISKNSSK 272
            |||...::
  Fly   259 WISSTIAR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 38/132 (29%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 59/253 (23%)
Tryp_SPc 38..263 CDD:238113 62/255 (24%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.