DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and scaf

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:282 Identity:65/282 - (23%)
Similarity:101/282 - (35%) Gaps:96/282 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIFNE--KQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESE 91
            |...|:  |.....::.|...|.||...|:   ::.|.||:|.|.:|..:.|:::|.||:.....
  Fly   412 CATRNKRTKPTGVKDLDANFAEIPWQAMIL---RESSKTLICGGAIIGDQFVLSSASCVNGLPVT 473

  Fly    92 SIYGVVFGDSDSSNINL--------VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLP 148
            .| .|..|:.:..:.|.        |..|.|||||.|....:|||||.|.:.:.|:..:||||:.
  Fly   474 DI-RVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICIS 537

  Fly   149 SVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKEC------------H 201
            .                    |.|.                      ||::|            |
  Fly   538 D--------------------EDPK----------------------DSEQCFTSGWGKQALSIH 560

  Fly   202 EK-----------QAR----FPEELICGHTERSPLS---GSALTEASGTPRQFHLLGIAVAGFFS 248
            |:           |||    .....:|..|:.....   ||||...||:       .:.:.|.|:
  Fly   561 EEGALMHVTDTLPQARSECSADSSSVCSATKFDSCQFDVGSALACGSGS-------SVRLKGIFA 618

  Fly   249 SDL---DHQGYLNIRPHLDWIS 267
            .:.   :.|.....:|.:.||:
  Fly   619 GENSCGEGQTVRFAKPDIKWIN 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 38/131 (29%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 56/240 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.