DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG17572

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:266 Identity:62/266 - (23%)
Similarity:105/266 - (39%) Gaps:67/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HPWVVRIVGV--TKDGSNTLLCTGILIDSRRVVTAAHC-VSKDESESIYGVVFGDSDSS------ 104
            :|:|.|| |.  ...|:....|.|.:|..|.::||||| ::|.:...:..|..|:.|:|      
  Fly   140 YPFVARI-GFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCA 203

  Fly   105 --------NIN-LVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSV-SEMVPGSET 159
                    ::| .:|.|.|||||...::.:|:|::.|...:.:|...|||||... :.:|.|...
  Fly   204 NTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRA 268

  Fly   160 SNS---KLIVAGLEGP----------SFD---RRHSATQRLDKRIKMTYTKIDSKECHEKQARFP 208
            :.:   |:..:.:..|          |:|   |.:.:|..|                 |......
  Fly   269 TIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGAL-----------------ESPNSIE 316

  Fly   209 EELICGHTERSPLSGSALTEA-SGTPRQFHLLGI-AVAGFFSSDLDHQG-------YLNIRPHLD 264
            .:.:|...|     |..:.:. .|.|......|| :..|..|...|:.|       |.::....:
  Fly   317 GQWMCAGGE-----GKDVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSE 376

  Fly   265 WISKNS 270
            ||..|:
  Fly   377 WIHDNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/140 (29%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 61/263 (23%)
Tryp_SPc 138..378 CDD:214473 59/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.