DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG4650

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:252 Identity:63/252 - (25%)
Similarity:109/252 - (43%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLL--CTGILIDSRRVVTAAHCV-SKDES 90
            ||:.      ::..||.....||:..:      .::.||  |.|.:|..:.|:|||||. :.::.
  Fly    28 CGLL------TNGKIANNISSPWMAYL------HTSELLYVCGGTVITEKLVLTAAHCTRASEQL 80

  Fly    91 ESIYGVVFGDSDSSNINL----VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVS 151
            .:..|...|..|:::..|    ||...:|..|:.....||:||:.|..::|||..::|||:  |.
  Fly    81 VARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICI--VW 143

  Fly   152 EMVPGSETSNSKLIVAGLEGPSFDRRHSATQRL-DKR---IKMTYTK-----IDSKECHEKQARF 207
            ..:......|.:::.....|...||..|...|: |.|   ..|..|.     :.|:.|    |..
  Fly   144 WTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFC----AGD 204

  Fly   208 PEELICGHTERSPLSGSALTEASGTPRQFHLLGIAV-------AGFFSSDLDHQGYL 257
            .:..:|.....||| |:.:|..:  .:::.|:|||.       |..::..|.|..::
  Fly   205 SDSKLCNVDFSSPL-GAIITFKN--IQRYVLIGIATTNQKCKRASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/130 (27%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 61/239 (26%)
Tryp_SPc 33..258 CDD:304450 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.