DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG9377

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:258 Identity:70/258 - (27%)
Similarity:110/258 - (42%) Gaps:55/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINL---- 108
            |.||:|.:.     ||:|.||:|.||....|:|.||||...|.|.: .::.|:.|:: :.|    
  Fly   111 EFPWLVAVY-----GSDTYLCSGALITPLAVITTAHCVQNSEMEKV-RLLAGEWDAA-VELEPQP 168

  Fly   109 -----VSAVTVHPDYSPRKFENDLAIIELTKEVVF--SDLVQPICLPSVSEMVPGSETSNSKLIV 166
                 |....|||:|:.....:::||:.:.||..|  :..|||||||.     |....:.|:..|
  Fly   169 HQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPP-----PRIMYNYSQCYV 228

  Fly   167 AGLEGPSFDRRHSATQRL-------DK-RIKMTYTKIDSKECHEKQ----ARFPEELICGHTERS 219
            :|.:...|.|.....:|.       |: |.|:..:.:..:..|...    .....:.:||..:.:
  Fly   229 SGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMT 293

  Fly   220 --PLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG------YLNIRPHLDWISKNSSKLR 274
              ||    :...||...:|||     ||..:......|      |.|::.:..||   ..|||
  Fly   294 AVPL----MCPLSGHDDRFHL-----AGLLTRTARCDGPQLLGIYTNVKLYRQWI---DLKLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 43/130 (33%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 67/252 (27%)
Tryp_SPc 105..339 CDD:214473 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.