DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and PRSS48

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:289 Identity:71/289 - (24%)
Similarity:115/289 - (39%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IQAASVGQECG--IFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAA 82
            |..:|:...||  :::.:.....:  |.....||.|.:     ...:..:|.|.|:..|.::|||
Human    33 ISLSSLSLVCGQPVYSSRVVGGQD--AAAGRWPWQVSL-----HFDHNFICGGSLVSERLILTAA 90

  Fly    83 HCVSKDESESIY-----GVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLV 142
            ||:....:...|     .:..|||.......||.:.:||.|  :....|:|:::|:.:|.|:..:
Human    91 HCIQPTWTTFSYTVWLGSITVGDSRKRVKYYVSKIVIHPKY--QDTTADVALLKLSSQVTFTSAI 153

  Fly   143 QPICLPSVSEM--------VPGSETSNSKLIVAGLEGPSFDR-RHSATQRLDKRIKMTYTKIDSK 198
            .|||||||::.        |.|          .|....|.|| .|||.|..:..|      ||.:
Human   154 LPICLPSVTKQLAIPPFCWVTG----------WGKVKESSDRDYHSALQEAEVPI------IDRQ 202

  Fly   199 ECHE-----------KQARFPEELIC-GHTE--RSPLSGSALTEASGTPRQFHLLGIAV-AGFFS 248
            .|.:           .:....|:.|| |.|:  :....|.     ||.|...|:.|:.: .|..|
Human   203 ACEQLYNPIGIFLPALEPVIKEDKICAGDTQNMKDSCKGD-----SGGPLSCHIDGVWIQTGVVS 262

  Fly   249 SDLD-----HQGYLNIRPHLDWISKNSSK 272
            ..|:     ...|.|:..:..||:...|:
Human   263 WGLECGKSLPGVYTNVIYYQKWINATISR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/136 (26%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 64/264 (24%)
Tryp_SPc 51..288 CDD:238113 66/266 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.