DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and psh

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:120/270 - (44%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IFNEKQYNSDNII---------AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVS 86
            |...||..|.|.:         .:|..:|.:..| |....|:: ..|.|.||.||.|:||||||:
  Fly   128 IRERKQQRSGNQLVIHIVGGYPVDPGVYPHMAAI-GYITFGTD-FRCGGSLIASRFVLTAAHCVN 190

  Fly    87 KDESESIY----GVVFGDSDSSNINLV-SAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPIC 146
            .|.:...:    .|...:.|.|..::| .:|.:||.|...|: ||:||:||.::||.:|.::|.|
  Fly   191 TDANTPAFVRLGAVNIENPDHSYQDIVIRSVKIHPQYVGNKY-NDIAILELERDVVETDNIRPAC 254

  Fly   147 LPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFP--- 208
            |.:.:...|    ||||..|||....:...|  |..::..|..:....:|  :|:...|..|   
  Fly   255 LHTDATDPP----SNSKFFVAGWGVLNVTTR--ARSKILLRAGLELVPLD--QCNISYAEQPGSI 311

  Fly   209 --------EELICGHTERSPLSGSALTEASGTP---------RQFHLLGIAVAGFFSSDLDHQGY 256
                    :.|:|...::  |...|....||.|         ..:.::|:..:||..:.:....|
  Fly   312 RLLKQGVIDSLLCAIDQK--LIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFGCATVTPGLY 374

  Fly   257 LNIRPHLDWI 266
            ..:..:||:|
  Fly   375 TRVSSYLDFI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 46/128 (36%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 68/253 (27%)
Tryp_SPc 144..387 CDD:238113 69/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.