DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG31220

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:107/261 - (40%) Gaps:62/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ECGIFNEKQYNSDNII--AEP--TEHPWVVRIVGVTKDGSN-----TLLCTGILIDSRRVVTAAH 83
            :||    |...::.:|  .||  .|:||:..::...:...|     ...|.|.||::|.|:||||
  Fly    94 DCG----KPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAH 154

  Fly    84 CVSKDESESIYGVVFGDSDSS-----------------NINL-VSAVTVHPDYSPRK--FENDLA 128
            ||: |....|..|..|:..:|                 :::: |.::|.|.||.|..  |.||:|
  Fly   155 CVT-DTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIA 218

  Fly   129 IIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGL-EGPSFDRRHSATQRLDKRIKMTY 192
            ::.|.:.|.::....|||:......:     ...|:.|||. :...||..       .|.:|...
  Fly   219 LVRLKEPVRYTMAYYPICVLDYPRSL-----MKFKMYVAGWGKTGMFDTG-------SKVLKHAA 271

  Fly   193 TKI-DSKECHEKQAR---FPEELIC--GHTERSPL---SGSALTEASGTPRQFH----LLGIAVA 244
            .|: ..:||.||.|.   .|...||  |...|...   |||.|...||  |.:.    |.||...
  Fly   272 VKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSG--RSYETITFLAGITSY 334

  Fly   245 G 245
            |
  Fly   335 G 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/150 (27%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 69/248 (28%)
Tryp_SPc 104..360 CDD:238113 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.