DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG8952

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:293 Identity:72/293 - (24%)
Similarity:122/293 - (41%) Gaps:59/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKLLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNII-----AEPTEHPWVVRIVGVTKDGS 63
            |.|:..||...::        |||.....|......||.|     |:..:.||.|.:   .:|..
  Fly     7 RSLMLVLLAAISV--------VGQPFDPANSSPIKIDNRIVSGSDAKLGQFPWQVIL---KRDAW 60

  Fly    64 NTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSA----VTVHPDYSPRKFE 124
            :.|||.|.:|....|:|||||.  :...||: ::||..|..|.|.::.    :.:||||:. |..
  Fly    61 DDLLCGGSIISDTWVLTAAHCT--NGLSSIF-LMFGTVDLFNANALNMTSNNIIIHPDYND-KLN 121

  Fly   125 NDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIK 189
            ||:::|:|.:.:.||..:|.|.|  |.:.....:...|...:||.       .::..:.||....
  Fly   122 NDVSLIQLPEPLTFSANIQAIQL--VGQYGDSIDYVGSVATIAGF-------GYTEDEYLDYSET 177

  Fly   190 MTYTK---IDSKECHEKQARF--PEELICGHTERSPLSGSALTEASG-----------TPRQFHL 238
            :.|.:   ||:.:|.....::  .:..:|.    ....||.::..:|           |.:|:..
  Fly   178 LLYAQVEIIDNADCVAIYGKYVVVDSTMCA----KGFDGSDMSTCTGDSGGPLILYNKTIQQWQQ 238

  Fly   239 LGIAVAGFFSSDLD----HQGYLNIRPHLDWIS 267
            :||  ..|.:.|..    ..||..:...|.:|:
  Fly   239 IGI--NSFVAEDQCTYRLPSGYARVSSFLGFIA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 39/127 (31%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 61/252 (24%)
Tryp_SPc 38..271 CDD:238113 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.