DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG14780

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:308 Identity:62/308 - (20%)
Similarity:98/308 - (31%) Gaps:119/308 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIFNEKQYNSDNII------AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSK 87
            |...:.::.....||      |:.|.|...:|::....:..:..:|.|.||..|:|:|||||:..
  Fly    20 CAAADLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCLYN 84

  Fly    88 DESE-----SIYGVVFG------DSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSD- 140
            ::.:     |.:.||.|      ..:.:.::.||::.....:||....:|:.|:.|...:..|. 
  Fly    85 NQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPG 149

  Fly   141 -----LVQPICLPSVSEMVPGSETSNSKLI-VAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKE 199
                 .|.||       .:.|..|...||. |||                               
  Fly   150 GGVHLTVAPI-------QLAGQITPPGKLCQVAG------------------------------- 176

  Fly   200 CHEKQARFPEELICGHTERSPLSGSALTEASGTPRQFH-----------LLGIAVAGFFSSDLD- 252
                         .|.||:|.||...||....|.|  |           |.|:..||......| 
  Fly   177 -------------WGRTEQSSLSNILLTANVSTIR--HQTCRMIYRSGLLPGMMCAGRLQGGTDS 226

  Fly   253 ----------HQG--------------------YLNIRPHLDWISKNS 270
                      |:|                    |:::..:..||...|
  Fly   227 CQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWIEGRS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/141 (25%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 58/290 (20%)
Tryp_SPc 33..271 CDD:238113 59/290 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.