DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and HGF

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_000592.3 Gene:HGF / 3082 HGNCID:4893 Length:728 Species:Homo sapiens


Alignment Length:277 Identity:67/277 - (24%)
Similarity:106/277 - (38%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITTL-HPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDS 75
            ||..| ||.|..|..         ||....|.|...|...|:|.:     ...|..:|.|.||..
Human   476 TIVNLDHPVISCAKT---------KQLRVVNGIPTRTNIGWMVSL-----RYRNKHICGGSLIKE 526

  Fly    76 RRVVTAAHCV-SKD--ESESIYGV----VFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELT 133
            ..|:||..|. |:|  :.|:..|:    ..||.....:..||.:...|:.|      ||.:::|.
Human   527 SWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGS------DLVLMKLA 585

  Fly   134 KEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKI-DS 197
            :..|..|.|..|.||:....:| .:||.|          .:...::.....|..:::.:..| .:
Human   586 RPAVLDDFVSTIDLPNYGCTIP-EKTSCS----------VYGWGYTGLINYDGLLRVAHLYIMGN 639

  Fly   198 KEC---HEKQARFPEELICGHTERSPLSGSALTEAS-GTP------RQFHLLGIAVAGFFSSDLD 252
            ::|   |..:....|..||...|:   .||...|.. |.|      :...:||:.|.|...:..:
Human   640 EKCSQHHRGKVTLNESEICAGAEK---IGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPN 701

  Fly   253 HQG-YLNIRPHLDWISK 268
            ..| ::.:..:..||.|
Human   702 RPGIFVRVAYYAKWIHK 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/130 (27%)
HGFNP_000592.3 PAN_APPLE 39..122 CDD:238074
KR 126..208 CDD:214527
KR 210..290 CDD:214527
KR 304..384 CDD:214527
KR 388..470 CDD:238056
Tryp_SPc 494..716 CDD:214473 55/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.