DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and GZMK

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:238 Identity:53/238 - (22%)
Similarity:93/238 - (39%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LCTGILIDSRRVVTAAHC---VSKDESESIYGVVFG-----DSDSSNINL-------VSAVTVHP 116
            :|.|:|||.:.|:|||||   .:|.:|.:   ||.|     .:::|...|       .|.||..|
Human    51 VCGGVLIDPQWVLTAAHCQYRFTKGQSPT---VVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDP 112

  Fly   117 DYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSAT 181
            .      .||:.:::|......:..|:.:.:.|.:.:..|::   .|:...|...|. ..|.|.|
Human   113 Q------SNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTK---CKVTGWGATDPD-SLRPSDT 167

  Fly   182 QRLDKRIKMTYTKIDSKECHEK-----QARFPEELIC---GHTERSPLSGSALTEASGTP----R 234
            .|     ::|.|.:..|.|:.:     .....::::|   ...::....|.     ||.|    .
Human   168 LR-----EVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGD-----SGGPLICKG 222

  Fly   235 QFHLL-------GIAV-AGFFSSDLDHQGYLNIRPHLDWISKN 269
            .||.:       |:|. .|.::        |..:.:..||..|
Human   223 VFHAIVSGGHECGVATKPGIYT--------LLTKKYQTWIKSN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 29/115 (25%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 50/233 (21%)
Tryp_SPc 27..257 CDD:238113 52/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.