DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Gzmk

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:267 Identity:62/267 - (23%)
Similarity:105/267 - (39%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GIFNEKQYNSDNII----AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDES 90
            ||:...:.....||    .:|...|::..|....|.     :|.|:||..:.|:|||||.|:..|
  Rat    14 GIYMSSESFHTEIIGGREVQPHSRPFMASIQYRGKH-----ICGGVLIHPQWVLTAAHCYSRGHS 73

  Fly    91 ESIYGVVFGDSDSSNINLVSAVTVHPDYSP----RKFENDLAIIELTKEVVFSDLVQPICLPSVS 151
            .::  |:...|.|.|..:.....: .::.|    :...||:.:|:|......:..||.:.|.|.:
  Rat    74 PTV--VLGAHSLSKNEPMKQTFEI-KEFIPFSGFKSGTNDIMLIKLRTAAELNKHVQLLHLRSKN 135

  Fly   152 EMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEK-----QARFPEEL 211
            .:..|     :|..|.|......|    .....|...::|.|.|..|.|:.:     :....:::
  Rat   136 YIRDG-----TKCQVTGWGSTKPD----VLTTSDTLQEVTVTIISRKRCNSQSYYNHKPVITKDM 191

  Fly   212 ICG---HTERSPLSGSALTEASGTP----RQFHLLGIAVAGFFSSDLDHQ-GYLNI--RPHLDWI 266
            ||.   ..|:....|.     ||.|    ..||.|   |:|.:...:.:: |...:  :.:..||
  Rat   192 ICAGDRRGEKDSCKGD-----SGGPLICKGVFHAL---VSGGYKCGISNKPGVYTLLTKKYQTWI 248

  Fly   267 SKNSSKL 273
               .|||
  Rat   249 ---KSKL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 32/127 (25%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 55/247 (22%)
Tryp_SPc 26..251 CDD:238113 57/252 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.