DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG18420

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:154 Identity:40/154 - (25%)
Similarity:64/154 - (41%) Gaps:30/154 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLTITTLHPTIQAAS-VGQECG----------IFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGS 63
            :|.:.|:.|.:.:.. :..|||          |.|.|       :|.....||:..:    ...|
  Fly    11 ILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGK-------VAVRNSSPWMAFL----HTSS 64

  Fly    64 NTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSS-----NINLVSAVTVHPDYSPRKF 123
            |..:|.|.||..|.|:|||||...:   :...|..|:.:..     ..:.|:....|..|.|...
  Fly    65 NQFICGGTLISRRLVLTAAHCFIPN---TTIVVRLGEYNRKLKGYREEHQVNRTFQHRFYDPNTH 126

  Fly   124 ENDLAIIELTKEVVFSDLVQPICL 147
            .||:|::.|...||:...::|||:
  Fly   127 ANDIALLRLVSNVVYKANIRPICI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/109 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 34/123 (28%)
Tryp_SPc 43..267 CDD:238113 34/122 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.