DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG18636

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:331 Identity:71/331 - (21%)
Similarity:98/331 - (29%) Gaps:125/331 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIFNEK------------QYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTA 81
            |||..:.            :|||.         ||:|.:...|    :..:|.|.||..:.|:||
  Fly    33 CGIRTQSRTAYRIINGHTAKYNSS---------PWMVFLHSTT----DMFVCGGSLITDKLVLTA 84

  Fly    82 AHC-------------VSKDESESIYGVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELT 133
            |||             ..:..||...|......:.   ::|.|...|..|.|....||:||:.|:
  Fly    85 AHCFIANQHLVARLGEYERTRSEECTGYYCNFREE---HMVDAGFKHKLYDPNTHANDIAILRLS 146

  Fly   134 KEVVFSDLVQPIC----------LPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLD--- 185
            |.||:.|.::|||          |..:           ..|...|......:....|.|.||   
  Fly   147 KSVVYRDNIRPICVVWDHRWRHYLDKI-----------DLLTATGWGKTQMESDSDALQTLDIRR 200

  Fly   186 -------KRIKMTYT-------KIDSKEC-------------HEKQARFPEELICGHTERSPLSG 223
                   |.|..|..       ..||..|             |:...||.:..|..:|.|:....
  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265

  Fly   224 SALTE-----------------------------ASGTPRQFHLLGIAVAGFFSSDLDHQGYLNI 259
            |..|:                             .:..|..:|...|....|...|.|    .|.
  Fly   266 SVFTDVLSHAEFILRVWRMYGKGQTLPIPKKPPTTTRPPTWWHTTRIPKQTFQDYDYD----TNH 326

  Fly   260 RPHLDW 265
            ..|.||
  Fly   327 GSHWDW 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/146 (25%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 58/260 (22%)
Tryp_SPc 45..278 CDD:238113 58/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.