DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG33226

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:300 Identity:75/300 - (25%)
Similarity:121/300 - (40%) Gaps:70/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITT--------LHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDG 62
            |:.|:|.:.:        |.|......||     ..|:.....|  |:...|||:|:|:   :.|
  Fly    14 LVCFILALRSYESLGQDLLDPNCVQTPVG-----VREQILGGHN--ADIKLHPWMVQIL---QRG 68

  Fly    63 SNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSD------------SSNINLVSAVTVH 115
            .:  .|.|.||.|..|:|||||.|:...:..:|...|.:.            ...|: |..:.:|
  Fly    69 YH--FCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEID-VKRIFLH 130

  Fly   116 PDYSPRKFEN-DLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLI------VAGLEGPS 173
            ..|  |.:.| |:|:..|.|.|.::...:|||:         .:|||...:      ||......
  Fly   131 SSY--RDYHNYDIALFLLAKPVRYNVQTRPICV---------LQTSNKDKLRQFLNYVAMFNVTG 184

  Fly   174 FDRRHSATQRLDKRIKMTYT--KIDSKEC---HEKQARFPEELIC-GHTERSPLSG------SAL 226
            :.:..|   :|...|..|.:  .:|.|.|   .:::..:|.  || ||::.|..:|      ||.
  Fly   185 WGKTES---QLTSTILQTTSLFHLDRKFCAQIFDRKIGWPH--ICAGHSQSSTCTGDSGGPLSAE 244

  Fly   227 TEASGTPRQFHLLGIAVAGFFSSDLDHQGYLNIRPHLDWI 266
            ...||..|.. |.||...| ..:..:...:.|:..:.:||
  Fly   245 LTFSGVKRTV-LFGIISYG-APNCREVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 39/142 (27%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 66/261 (25%)
Tryp_SPc 47..282 CDD:214473 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442140
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.