DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Prss45

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:216 Identity:53/216 - (24%)
Similarity:83/216 - (38%) Gaps:80/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DNIIAEPTEH-PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDS-- 101
            ||:  |.:.| ||...:....|.     :|.|.|||...||:||||:..::.   |.|:.|.|  
Mouse    53 DNL--EESHHWPWEASLQIEDKH-----VCGGALIDRSWVVSAAHCIQGNKE---YSVMLGSSTL 107

  Fly   102 --DSSNINL---VSAVTVHPDYSPRKF-ENDLAIIELTKEVVFSDLVQPICLP------------ 148
              :.|:..|   |..:.:||.|..|.| .:|:|::.|...|.|:..|||||||            
Mouse   108 HPNGSSWTLKIPVGDIIIHPKYWGRNFIRSDIALLCLETPVTFNKYVQPICLPEHNFNFKVGTKC 172

  Fly   149 -----------SVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKEC-- 200
                       |.:::.|..|...:::.:                            ||:|.|  
Mouse   173 WVTGWGQVKQHSSAQLTPAPELWEAEVFI----------------------------IDNKNCDS 209

  Fly   201 -HEKQARFPE-------ELIC 213
             ..|:..:|:       .:||
Mouse   210 IFHKKTLYPQVVPLIRKNMIC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 43/155 (28%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 50/208 (24%)
Tryp_SPc 59..286 CDD:214473 50/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833216
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.