Sequence 1: | NP_001287432.1 | Gene: | CG31205 / 318626 | FlyBaseID: | FBgn0051205 | Length: | 274 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_694812.1 | Gene: | Prss45 / 260408 | MGIID: | 3605764 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 216 | Identity: | 53/216 - (24%) |
---|---|---|---|
Similarity: | 83/216 - (38%) | Gaps: | 80/216 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 DNIIAEPTEH-PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDS-- 101
Fly 102 --DSSNINL---VSAVTVHPDYSPRKF-ENDLAIIELTKEVVFSDLVQPICLP------------ 148
Fly 149 -----------SVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKEC-- 200
Fly 201 -HEKQARFPE-------ELIC 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31205 | NP_001287432.1 | Tryp_SPc | 44..>168 | CDD:304450 | 43/155 (28%) |
Prss45 | NP_694812.1 | Tryp_SPc | 59..289 | CDD:238113 | 50/208 (24%) |
Tryp_SPc | 59..286 | CDD:214473 | 50/208 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167833216 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |