DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and mst1

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_694512.1 Gene:mst1 / 259260 ZFINID:ZDB-GENE-020806-3 Length:709 Species:Danio rerio


Alignment Length:286 Identity:60/286 - (20%)
Similarity:104/286 - (36%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITTLHPTIQAASVGQECGIFNEKQYNSDNII-AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSR 76
            :..:.||.:...  .|||...::..:...|: ..|...||.|.:    :|......|.|.|:.|.
Zfish   455 VPIIGPTTEVEF--NECGKREDRLRSRLRIVGGTPGNSPWTVSL----RDRKGNHFCGGSLVSSE 513

  Fly    77 RVVTAAHCVSKDESE-----SIYGVVF-----GDSDSSNINLVSAVTVHPDYSPRKFENDLAIIE 131
            .|::...|.|....:     ::.|.:|     |:.|...|:|...|.     .|.  |:.|.:::
Zfish   514 WVISTKQCFSSCYVDLTGYTAMMGTLFRDPKEGEPDLQRISLTKIVC-----GPS--ESHLVMLQ 571

  Fly   132 LTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG---LEGPSFDRRHSATQRLDKRIKMTYT 193
            |.....|::.|..||||....:||......    :||   .:|...:...:..|         ..
Zfish   572 LETPAQFNERVSQICLPPERYIVPDGTICE----IAGWGETKGKGDETVLNVAQ---------MP 623

  Fly   194 KIDSKECHEK-QARFPEELIC--------GHTER---SPLSGSALTEASGTPRQFHLLGIAVAGF 246
            .:.:|:|::. :.|..|..:|        |..||   .||       |......:.|.|:.:.  
Zfish   624 VLSNKDCNQYFKGRVRENEMCTMAFQAGVGACERDYGGPL-------ACQNSDCWVLEGVIIP-- 679

  Fly   247 FSSDLDHQG----YLNIRPHLDWISK 268
             .....|.|    ::.:..::|||.|
Zfish   680 -MRRCGHAGQPNIFIRVSVYVDWIKK 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/133 (23%)
mst1NP_694512.1 PAN_AP_HGF 24..105 CDD:238532
KR 109..187 CDD:238056
KR 192..271 CDD:214527
KR 284..365 CDD:214527
KR 370..451 CDD:238056
Tryp_SPc 481..702 CDD:214473 52/254 (20%)
Tryp_SPc 482..705 CDD:238113 55/257 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.