DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and KLK5

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:200 Identity:50/200 - (25%)
Similarity:79/200 - (39%) Gaps:51/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWSRKLLTFLLTITTL---------------HP--TIQAAS---VGQECGIFNEKQYNSDNII-- 43
            ||   :|..|:|...|               ||  |:.:.|   :|...|.......:|..||  
Human     9 MW---VLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIING 70

  Fly    44 --AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFG------- 99
              .:....||...::    ...|.|.|..:|:..:.::|||||..|     ::.|..|       
Human    71 SDCDMHTQPWQAALL----LRPNQLYCGAVLVHPQWLLTAAHCRKK-----VFRVRLGHYSLSPV 126

  Fly   100 -DSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSK 163
             :|.......|.::. ||.||.....|||.:|:|.:.:..:..|:||   :||...|.:.|   |
Human   127 YESGQQMFQGVKSIP-HPGYSHPGHSNDLMLIKLNRRIRPTKDVRPI---NVSSHCPSAGT---K 184

  Fly   164 LIVAG 168
            .:|:|
Human   185 CLVSG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 34/131 (26%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 7/30 (23%)
Tryp_SPc 66..285 CDD:214473 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.