Sequence 1: | NP_001287432.1 | Gene: | CG31205 / 318626 | FlyBaseID: | FBgn0051205 | Length: | 274 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070959.1 | Gene: | KLK5 / 25818 | HGNCID: | 6366 | Length: | 293 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 50/200 - (25%) |
---|---|---|---|
Similarity: | 79/200 - (39%) | Gaps: | 51/200 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MWSRKLLTFLLTITTL---------------HP--TIQAAS---VGQECGIFNEKQYNSDNII-- 43
Fly 44 --AEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFG------- 99
Fly 100 -DSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSK 163
Fly 164 LIVAG 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31205 | NP_001287432.1 | Tryp_SPc | 44..>168 | CDD:304450 | 34/131 (26%) |
KLK5 | NP_001070959.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 37..68 | 7/30 (23%) | |
Tryp_SPc | 66..285 | CDD:214473 | 36/139 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |