DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30323

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:306 Identity:59/306 - (19%)
Similarity:101/306 - (33%) Gaps:72/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEH--PWVVRIVGVTKDGSNTLLC 68
            ||..|||.:...   .....|.:..::....|:.:.:.....:|  .|          |.|. .|
  Fly     4 LLLLLLTSSAYS---NEGKKGLQRNLYVTDNYHQNVVSIRTRKHIRHW----------GDNH-FC 54

  Fly    69 TGILIDSRRVVTAAHCVS---------------------------KDESESIYGV---VFGDSDS 103
            .|.|:.:..|||:..|||                           |...::||.|   |..:|..
  Fly    55 AGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDESAI 119

  Fly   104 SNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDL----VQPICLPSVSEMVPGSETSNSKL 164
            |....::.:.:....:.::|...|...||....:.:.|    :..:....:|.|.|.........
  Fly   120 SGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVYISAMCPAFSMVYDNP 184

  Fly   165 IVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELIC--GHTERSPLSGSALT 227
            :....:||     :|:     :.|::...||...||....:|    .:|  .:|.|    |:...
  Fly   185 VTWFQDGP-----YSS-----ELIQIRAQKISEYECKPDCSR----CLCMTSYTGR----GNMCQ 231

  Fly   228 EASGTPR--QFHLLGIAVAGFFSSDLDHQGYLNIRPHLDWISKNSS 271
            :..|:|.  ...|.|:|.......|.....|.||..:..:|....|
  Fly   232 QDLGSPLFCDHFLYGVARRVHTCDDEGFMFYTNIYQNRKFIEDTLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 28/159 (18%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 50/258 (19%)
Tryp_SPc 45..272 CDD:214473 49/255 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.