DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30289

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:307 Identity:78/307 - (25%)
Similarity:120/307 - (39%) Gaps:88/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPT---EHPWVVRIVGVTKDGSNTLL 67
            ::..|:.:...:..:.:..:.:.|||..:..|..:......|   |:||:| :|..:|.      
  Fly     7 VIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMV-LVWSSKP------ 64

  Fly    68 CTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDS----------------SNINLVSAVTVHP 116
            |.|.||..:.|:|||||||   .|.:| |..||.::                .||: |....||.
  Fly    65 CGGSLIARQFVLTAAHCVS---FEDLY-VRLGDYETLDPMPYCLNNHCIPKFYNIS-VDMKIVHE 124

  Fly   117 DYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG---LEGPSFDRRH 178
            :|:....:||:|::.:::.|.:||.|:||||     :|.....|.....|.|   .|...|.|  
  Fly   125 NYNGITLQNDIALLRMSEAVEYSDYVRPICL-----LVGEQMQSIPMFTVTGWGETEYGQFSR-- 182

  Fly   179 SATQRLDKRIKMTYTKIDSKECH---EKQARFPEELIC--GHTERS-------PLS-----GSAL 226
                   ..:..|...:|...|:   .|||  ....||  .||..:       |||     |:.|
  Fly   183 -------ILLNATLYNMDISYCNIKFNKQA--DRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRL 238

  Fly   227 TEASGTPRQFHLLGIA-------VAGFFSSDLDHQGYLNIRPHLDWI 266
            ...     |:.|:...       |||.         |.|:..|.:||
  Fly   239 LSF-----QYGLVSYGSERCAANVAGV---------YTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 44/142 (31%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 71/270 (26%)
Tryp_SPc 42..271 CDD:238113 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.