DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30187

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:295 Identity:69/295 - (23%)
Similarity:119/295 - (40%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WSRKLLTFLLTITTLHPTIQAASV--GQECGIFNEKQYNSDNIIAEPT--------EHPWVVRIV 56
            |...:..||..:        .||:  .|.|||         ||..:.|        ...|:..:.
  Fly     7 WIPVIFWFLKDV--------GASIFLDQICGI---------NIALKITGGHNAAFQNSVWMAAVH 54

  Fly    57 GVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTVHPDYSPR 121
            ..|.     .:|.|.||..|.|:|||||:...:.:|:....:..||.::...|....||..:..|
  Fly    55 NRTH-----FICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDPADRKDVITAVVHSSFDVR 114

  Fly   122 -KFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLD 185
             .:|||:.:::|:.:|:|:.|::|||:.....|  .:...|.:...|...|   ..|.:.|..:.
  Fly   115 ASYENDIGLLKLSSDVIFNALIRPICIVLNKSM--ANHMRNMRTFKAFGWG---TLRGNKTSDIL 174

  Fly   186 KRIKMTYTKIDSKECHEKQARFPEEL----------ICGHTERSPLSGSALTEASGTPR-QFHLL 239
            :.|.:.:  :|.:||:.:.:.:|.|.          .||.....||:.....:..|... ||.::
  Fly   175 QTIILNH--LDREECYMELSVYPSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGII 237

  Fly   240 GIAVAGFFSSDLDHQG-YLNIRPHLDWISKNSSKL 273
            .:.     .:..|.|| |.::....|||.....:|
  Fly   238 SVG-----KTSCDGQGVYTDLMSFADWIKMTIERL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/132 (25%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 55/241 (23%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.