DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30098

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:275 Identity:66/275 - (24%)
Similarity:118/275 - (42%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHPTIQAASVGQEC-GIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCT 69
            |||||: |.||.....:..:..:| .:|..:.....|  |..|  ||:..::   :|  |...|.
  Fly     7 LLTFLV-ILTLGSYGYSQLLDSKCIALFRIRVIGGQN--ARRT--PWMAYLI---RD--NRFACG 61

  Fly    70 GILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNIN-------LVSAVTVHPDYSPRKFEN-D 126
            |.||..|.|:|||||...:::   ..|..|:.|||...       .|.::..|.:|.  .|.| |
  Fly    62 GSLIAYRFVLTAAHCTKINDN---LFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYI--DFRNHD 121

  Fly   127 LAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLD-KRIKM 190
            :|:::|.::||:...::|||:...|.:...:.:..:..:....:...:.:..:..|.:. :|::.
  Fly   122 IAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRN 186

  Fly   191 TYTKIDSKE--CHEKQARFPEELICGHTERSPLSGSALTEASGTPR-QFHLLGIAVAGFFSSDLD 252
            .|..:.|..  |..     |.:..|......|| ||.:.....|.. ||     .|....:.:.|
  Fly   187 EYCGVPSLSICCWN-----PVQYACFGDSGGPL-GSLVKYGHKTIYVQF-----GVTNSVTGNCD 240

  Fly   253 -HQGYLNIRPHLDWI 266
             :..||::..::.|:
  Fly   241 GYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/131 (27%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 55/242 (23%)
Tryp_SPc 37..258 CDD:238113 56/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.