DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30090

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:288 Identity:65/288 - (22%)
Similarity:111/288 - (38%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IQAASVGQECGIFNEKQY-----------------NSDNIIAEPTEHPWVVRIVGVTKDGSNTLL 67
            |.|.::|..|.:.|.:..                 ..|.||   ..:||:..|....|     |:
  Fly     8 ITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAII---NSNPWMAYIHSSVK-----LI 64

  Fly    68 CTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTV-------------HPDYS 119
            |.|.||..|.|:||||||::..:..:....:.|:.:.:.|  |.:.:             |..:|
  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCN--SKICIPRAEEHDVDMAFRHGKFS 127

  Fly   120 PRKFENDLAIIELTKEVVFSDLVQPICL---PSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSAT 181
            ..|..||:|::.|.|.|.|...:.|||:   .|..|:|...|.    .:..|.       ..:.|
  Fly   128 EIKNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEW----FVATGW-------GETRT 181

  Fly   182 QRLDKRIKMT-YTKIDSKECHEKQARFPEE-LIC----GHTERSPLSGSALTEASGTPRQFHLLG 240
            .|....:::| ..:.:|.:|.:...|..:: .||    |....:..||..|.:......:...:.
  Fly   182 HRTRGVLQITQLQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQ 246

  Fly   241 IAVAGFFSSDLDHQG-YLNIRPHLDWIS 267
            ..|..:.|.:....| |.::..:.|||:
  Fly   247 FGVVSYGSRECSGIGVYTDVYSYADWIA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 37/139 (27%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 58/254 (23%)
Tryp_SPc 40..276 CDD:238113 60/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.