DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG30087

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:306 Identity:68/306 - (22%)
Similarity:119/306 - (38%) Gaps:87/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLTITTLHP--TIQAASVGQECGIFNEKQ-----YNSDNIIAEPTEHPWVVRIVGVTKDGSNTL 66
            |::.|..:..  .:.|..:...||:..|.|     .|....:....  |::|.:.      :|:|
  Fly     8 FVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSA--PFMVYVT------NNSL 64

  Fly    67 L-CTGILIDSRRVVTAAHCVSKD------ESESIYGVVFGDSD---------SSNINLVSAVTVH 115
            . |.|.:::||.::||||||..:      |..     :..|.|         |....::.|:| |
  Fly    65 THCGGSILNSRYILTAAHCVFPNLRLRLGEHN-----IRTDPDCQGSNCSPRSEEYGIMKAIT-H 123

  Fly   116 PDYSPRKFENDLAIIELTKEVVFSDLVQPICL-------PSVS--EMVPGSETSNSKL--IVAGL 169
            ..|:.....||:|:::|.:.:.|:..:||||:       |||:  :.....||..:..  ::...
  Fly   124 RFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTA 188

  Fly   170 EGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELIC-GHTERSPLSGSALTEASGTP 233
            |..::|..:.                 |:..|   |......|| ||.||...:|.     ||.|
  Fly   189 ELRAYDAAYC-----------------SRSFH---AYMNGNQICAGHEERDTCAGD-----SGGP 228

  Fly   234 ----------RQFHLLGIAVAGFFSSDLDHQG-YLNIRPHLDWISK 268
                      :::..|||...|  .:|....| |..:..:::||.:
  Fly   229 LVTRVDFDGVKRYLQLGIVSYG--PTDCQSPGVYTYVPNYINWIRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 36/150 (24%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 59/269 (22%)
Tryp_SPc 42..272 CDD:238113 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.