DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and try-4

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:299 Identity:72/299 - (24%)
Similarity:107/299 - (35%) Gaps:107/299 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLTFLLTITTLHP-------------TIQAASVGQE-CGIFNEKQYNSDNIIAEPTEHPWVVRIV 56
            ::.|.:.:.|..|             ||....|..| |||..|.:..:         .||.   |
 Worm    10 IIIFTVPVITFEPVWIGNAFSMESFQTIVDNEVLMESCGIQQESKIKN---------FPWA---V 62

  Fly    57 GVTKDGSNTLLCTGILIDSRRVVTAAH------------CVSKD---ESESIY----------GV 96
            ..|.||.|.|  .|.:|....::||||            |.:|:   .:.|||          .|
 Worm    63 SFTVDGVNRL--GGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTRKV 125

  Fly    97 VFGDS---------------DSSNI--NLVSAVTVHPDYSPRKF--ENDLAIIELTKEVVFSDLV 142
            .:|.:               ..|::  |.|.||.|..:::....  .:|.||:|:.|.:.||:.|
 Worm   126 AYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENV 190

  Fly   143 QPICLP------SVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECH 201
            :|||||      :.|..|||...|    .:....||..   |....|:|:..|..::.       
 Worm   191 RPICLPRPNMYYTKSLAVPGWGRS----YIFNESGPLI---HEIPMRIDRDCKRPWSD------- 241

  Fly   202 EKQARFP---EELICGHTERSPLSGSALTEASGTPRQFH 237
                |.|   ::.||. |..:..:.||       ||..|
 Worm   242 ----RLPADADDFICA-TSMNVSNYSA-------PRTCH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 45/173 (26%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 62/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.