DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Mst1

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_032269.3 Gene:Mst1 / 15235 MGIID:96080 Length:716 Species:Mus musculus


Alignment Length:273 Identity:58/273 - (21%)
Similarity:97/273 - (35%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVT 80
            |.|..|.  |.::||...:|......:...|...||.|.:    ::......|.|.|:..:.|:|
Mouse   466 LDPPDQV--VFEKCGKRVDKSNKLRVVGGHPGNSPWTVSL----RNRQGQHFCGGSLVKEQWVLT 524

  Fly    81 AAHCV-SKDESESIYGVVF---------GDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKE 135
            |..|: |..|..:.|.|..         |:::...:.:..||.     .|.  .:.|.:::|.:.
Mouse   525 ARQCIWSCHEPLTGYEVWLGTINQNPQPGEANLQRVPVAKAVC-----GPA--GSQLVLLKLERP 582

  Fly   136 VVFSDLVQPICLPSVSEMV-PGSE-----------TSNSKLIVAGLEGPSFDRRHSATQRLDKRI 188
            |:.:..|..||||....:| ||::           |||:.::            |.|:..:    
Mouse   583 VILNHHVALICLPPEQYVVPPGTKCEIAGWGESIGTSNNTVL------------HVASMNV---- 631

  Fly   189 KMTYTKIDSKECHEKQARFPEELICGHTERSPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDH 253
                  |.::||:.|..        ||.:.|.:....|....|          |..|      |:
Mouse   632 ------ISNQECNTKYR--------GHIQESEICTQGLVVPVG----------ACEG------DY 666

  Fly   254 QGYLNIRPHLDWI 266
            .|.|....|..|:
Mouse   667 GGPLACYTHDCWV 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 33/145 (23%)
Mst1NP_032269.3 PAN_1 25..96 CDD:278453
KR 108..188 CDD:214527
KR 191..269 CDD:214527
KR 291..372 CDD:214527
KR 377..459 CDD:214527
Tryp_SPc 488..709 CDD:214473 51/249 (20%)
Tryp_SPc 489..712 CDD:238113 51/248 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833178
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.