DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Hgf

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001276387.1 Gene:Hgf / 15234 MGIID:96079 Length:728 Species:Mus musculus


Alignment Length:278 Identity:65/278 - (23%)
Similarity:105/278 - (37%) Gaps:54/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITTL-HPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDS 75
            ||..| ||.|..|..         ||....|.|...|...|:|.:     ...|..:|.|.||..
Mouse   477 TIVNLDHPVISCAKT---------KQLRVVNGIPTQTTVGWMVSL-----KYRNKHICGGSLIKE 527

  Fly    76 RRVVTAAHCV---SKD--ESESIYGV----VFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIE 131
            ..|:||..|.   :||  :.|:..|:    ..|:.....|..:|.:...|:.|      ||.:::
Mouse   528 SWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGS------DLVLLK 586

  Fly   132 LTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKID 196
            |.:..:..:.|..|.|||....:|...|       ..:.|..:....:|...|  |:...|. :.
Mouse   587 LARPAILDNFVSTIDLPSYGCTIPEKTT-------CSIYGWGYTGLINADGLL--RVAHLYI-MG 641

  Fly   197 SKEC---HEKQARFPEELICGHTERSPLSGSALTEAS-GTP------RQFHLLGIAVAGFFSSDL 251
            :::|   |:.:....|..:|...|:   .||...|.. |.|      :...:||:.|.|...:..
Mouse   642 NEKCSQHHQGKVTLNESELCAGAEK---IGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIP 703

  Fly   252 DHQG-YLNIRPHLDWISK 268
            :..| ::.:..:..||.|
Mouse   704 NRPGIFVRVAYYAKWIHK 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/132 (23%)
HgfNP_001276387.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 53/247 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.