DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and Gzma

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:256 Identity:68/256 - (26%)
Similarity:97/256 - (37%) Gaps:49/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGV-V 97
            |:....|.::  |...|:    :.:.|..||| :|.|.||:...|:|||||.....|:.|.|. .
Mouse    27 ERIIGGDTVV--PHSRPY----MALLKLSSNT-ICAGALIEKNWVLTAAHCNVGKRSKFILGAHS 84

  Fly    98 FGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMV-PGSETSN 161
            ........|..|.....:|.|.....|.||.::.|.|:...:..|..:.||...:.| ||     
Mouse    85 INKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPG----- 144

  Fly   162 SKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECH-EKQARFPE----ELIC------GH 215
            ::..|||  ...|..:.:.::.|.   ::..|.||.|.|: ||...|..    .:||      |.
Mouse   145 TRCRVAG--WGRFGNKSAPSETLR---EVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGK 204

  Fly   216 TERSPLSGSALTEASGTPRQFHLLGIAVAG--------FFSSDLDHQGYLNIRPHLDWISK 268
            ...:..|||.|. ..|..|.....|....|        .|.||          .||:||.|
Mouse   205 DSCNGDSGSPLL-CDGILRGITSFGGEKCGDRRWPGVYTFLSD----------KHLNWIKK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/125 (28%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 64/251 (25%)
Tryp_SPc 29..255 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833220
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.