DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG43742

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:238 Identity:58/238 - (24%)
Similarity:92/238 - (38%) Gaps:69/238 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDSDSS--------NINLVSAVTVHPDYS 119
            ::...|.|.||..:.|:||||||...:..:::   .|:::.|        .:.|.:.|.:||::.
  Fly    53 NSEFFCGGSLIHKQYVLTAAHCVRDLDEVTVH---LGENNRSCPIPVCKHVLRLNAKVILHPNFH 114

  Fly   120 PRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQ-- 182
            ...|.||:|::.|.:||:|...::|||: .:.|.|..:..:|......|      ...|....  
  Fly   115 GNIFLNDIALLRLEREVIFEAHIRPICI-ILDEDVTSNNQNNFTAYGWG------KTEHGNISDV 172

  Fly   183 -------RLDKRIKMTYTKIDSKECHEKQARFPEELIC-GHTERSPLSGSALTEASGTP------ 233
                   ||.|  .|.|..|::              || |.|     ||......||.|      
  Fly   173 LSFIDLVRLPK--SMCYQNINT--------------ICAGST-----SGDTCESDSGGPLIGNFV 216

  Fly   234 -----RQFHLLGIAVAGFFSSDLDHQG----YLNIRPHLDWIS 267
                 |.. |.||...|    |.:..|    |.::..:..||:
  Fly   217 HRGKSRDI-LFGITSYG----DAECSGLFGVYTDVNAYKSWIA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/112 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 56/235 (24%)
Tryp_SPc 35..256 CDD:238113 58/238 (24%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.