DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG43110

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:270 Identity:55/270 - (20%)
Similarity:100/270 - (37%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TTLHPTIQAASVGQE-----CGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILI 73
            |.:...|..::..|:     .||||             |.|                |||.|.:|
  Fly    31 TPVPKIISGSNASQQSAQYMAGIFN-------------TTH----------------LLCGGTII 66

  Fly    74 DSRRVVTAAHCVSKDESESIYGVVFGDSDSSNINLVSAVTVHPDYSPRKFENDLAIIELTKEVVF 138
            ....|:|.|||.|........|....:..:..|.::..: .||.||...:.||:|:::|.:.|:|
  Fly    67 HEDFVLTVAHCKSTQTLFVRLGAYNINHPTDQIRVIETI-AHPQYSNSTYANDIALVKLERSVIF 130

  Fly   139 SDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEK 203
            :..:||||:...:.:  |.:       :.......:.|..:|.|. |...::...:.:...||..
  Fly   131 NLNIQPICIHLDATL--GKQ-------IRYYNAFGWGRTRNAEQS-DILQRIFVNRTNPMICHLY 185

  Fly   204 QARFPE-ELICGHTER---------SPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG-YL 257
            ....|: :.||..|::         .||......:......||     .:..:.:.:.:..| |.
  Fly   186 LGMSPDPKQICATTDQGDTCAGDSGGPLISKITYQGKNFDTQF-----GITSYGTRECNGVGLYT 245

  Fly   258 NIRPHLDWIS 267
            ::..:..||:
  Fly   246 DVSQYSGWIA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 30/123 (24%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 52/263 (20%)
Tryp_SPc 36..257 CDD:238113 54/265 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.