DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and CG43124

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:231 Identity:52/231 - (22%)
Similarity:99/231 - (42%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI-YGVVFGDSDSSNINLVSA-- 111
            ||:..|:..:|     ::|.|.||::..|:|||.|..::|..:: .|..:.|....|..:..|  
  Fly    41 PWLAEILSDSK-----VICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVTKAYF 100

  Fly   112 -VTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSFD 175
             :|    :.|....|:|.|..|..||.|...::|:|:           |.:.|.:  ||.     
  Fly   101 WMT----HFPANNTNNLCIFRLQTEVEFKTHIRPMCI-----------TKSPKSL--GLA----- 143

  Fly   176 RRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTE---RSPLSGSALTEASGTPRQFH 237
               :..:.::::.||.|.      |...:..|. :.:.|..|   :|..:||..||.........
  Fly   144 ---TTFEIINEKPKMWYF------CKNIKGLFC-KYVFGENEEKWQSKPTGSPWTETISNGPFKG 198

  Fly   238 LLGIAVAGFFSSDLDHQGYLNIRPHLDWISKNSSKL 273
            |:...:..:..:....:.|:|:..|::||::.|.::
  Fly   199 LVRYGILSYRDNKTYDEVYINVMSHINWIAQISLEI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/121 (26%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.