DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31205 and plaua

DIOPT Version :9

Sequence 1:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:250 Identity:58/250 - (23%)
Similarity:99/250 - (39%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PWVVRIVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI--YGVVFGDSDSSNIN----- 107
            ||:..|  ...||   .:|.|.||....|:|||||....:...|  |.||.|.:..:..:     
Zfish   176 PWMAAI--FKGDG---FICGGTLITPCWVLTAAHCFPTGKRTQINRYSVVLGKNAINETDPVKEQ 235

  Fly   108 --LVSAVTVHP--DYSPRKFENDLAIIELT----KEVVFSDLVQPICLPSVSEMVPGSETSNSKL 164
              .||.:.:|.  |||...:.:|:|::::.    :..|.:..|:..|||...:|:|         
Zfish   236 KFTVSRLVIHEDFDYSTENYTHDIALLKIEDCNGQCAVKTKTVRTACLPPFQQMLP--------- 291

  Fly   165 IVAGL--EGPSFDRRHSATQRLDKRIKMTYTK-IDSKEC---HEKQARFPEELICGHTE------ 217
              .|.  |...:.|....|.:..:.:|.|..| |..|.|   :..:....|.::|.:..      
Zfish   292 --VGFYCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVCQRTYYNKDEVNENMLCANGRDWKTDA 354

  Fly   218 -RSPLSGSALTEASGTPRQFHLLGIAVAGFFSSDLDHQG-YLNIRPHLDWISKNS 270
             :....|..:.|.:..   ..|.||...|...::.:..| |..:..:..|||:::
Zfish   355 CQGDSGGPLVCEVNNI---MFLFGIISWGKECAEKNQPGVYTQVSNYNQWISQHT 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 35/132 (27%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.