DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-Ic and MAN1C1

DIOPT Version :9

Sequence 1:NP_733331.1 Gene:alpha-Man-Ic / 318624 FlyBaseID:FBgn0051202 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001372111.1 Gene:MAN1C1 / 57134 HGNCID:19080 Length:664 Species:Homo sapiens


Alignment Length:492 Identity:199/492 - (40%)
Similarity:290/492 - (58%) Gaps:46/492 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RAKIKEMMMHAWRNYARVVWGTNEFRPISRRVHFGGDFATYK----------------------- 113
            |.||||||..||::|.|...|.||.||:::..:.|..|....                       
Human   175 REKIKEMMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGANPSGEDRVAGKADPCVMPLVMKAGE 239

  Fly   114 ----------LGATIIESLDTLHLMGLNKELRRSRDWIEKSFHLDRVDEALSVYELTSRLLCPML 168
                      .|||:|:|||||:||.|.:|.:.::.|:.:||||:...|| |::|:..|.:..:|
Human   240 NQRRQGDRGLSGATVIDSLDTLYLMELKEEFQEAKAWVGESFHLNVSGEA-SLFEVNIRYIGGLL 303

  Fly   169 TLYSLTGDSLYMDKAIHIADKILPAFDTPTGIPRRLVVPKEGSTLTKYLSDISRTSEFGSLHLEF 233
            :.:.|||:.::..|||.:.:|:||||:||||||:.:|..|.|:.........|..:|||||||||
Human   304 SAFYLTGEEVFRIKAIRLGEKLLPAFNTPTGIPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEF 368

  Fly   234 YYLSEVSGYPVYRERVDAIREILAKTTRPNGLYPNAYCTKFGKWENYNCSMHRL----YDTLLKS 294
            .:|:|:||..|:.|:|..||::|.|..:|.|||||......|.|..::.|:..|    |:.|:||
Human   369 LHLTELSGNQVFAEKVRNIRKVLRKIEKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKS 433

  Fly   295 WIQSGRTDTQNADTFKEAMLAVAQNLVVINPEDVTYVSTFRNGTLFHRMRHSDCFAGGLFVLGAA 359
            |:.||:||.:..:.:.||:.|:...|:.::|..:||::.:|.|.|.|:|.|..||:||:..|||.
Human   434 WLMSGKTDMEAKNMYYEALEAIETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAE 498

  Fly   360 ETQMKHWEKYAHIGIGLTDTCHDSYWSSPTRLGPDTFAFTEESQQEIEPLQRNYYNLRPEVAETY 424
            :.:.:....|..:...:|.|||:||..|.|:|||:.|.|....:.....|..:||.|||||.|:|
Human   499 DAKEEKRAHYRELAAQITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESY 563

  Fly   425 LVLWRITHHPQYRLWGLEMVQAIEKYCRMPYGYTGVMDVNNVTSEPDDVQGSFFLGSTLKYLYLL 489
            :.|||.||:|.||.||.|:|.|:|||||...|::|:.||.:.|...|:.|.||||..||||||||
Human   564 MYLWRQTHNPIYREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLL 628

  Fly   490 FSDDDVVSLEQWVFNSAGHFLPIKGVNPMYRQHNSSN 526
            ||:||::|||.||||:..|.||:        .|:.|:
Human   629 FSEDDLLSLEDWVFNTEAHPLPV--------NHSDSS 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Man-IcNP_733331.1 Glyco_hydro_47 78..512 CDD:279825 191/470 (41%)
MAN1C1NP_001372111.1 Glyco_hydro_47 181..651 CDD:396217 191/470 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149706
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54359
OrthoDB 1 1.010 - - D263455at33208
OrthoFinder 1 1.000 - - FOG0001280
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100239
Panther 1 1.100 - - O PTHR11742
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X635
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.