DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-Ic and man1b1b

DIOPT Version :9

Sequence 1:NP_733331.1 Gene:alpha-Man-Ic / 318624 FlyBaseID:FBgn0051202 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001093449.1 Gene:man1b1b / 556237 ZFINID:ZDB-GENE-070705-482 Length:632 Species:Danio rerio


Alignment Length:464 Identity:155/464 - (33%)
Similarity:248/464 - (53%) Gaps:48/464 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IKEMMMHAWRNYARVVWGTNEFRPISRRVHFGGDFATYKLGATIIESLDTLHLMGLNKELRRSRD 139
            ::|...|||:.|....||.:|.:|||:..   |::  :.||.|:|::|||:.::||.:|...:|:
Zfish   186 VREAFRHAWKGYKDFAWGHDELKPISKSY---GEW--FGLGLTLIDALDTMWILGLQEEFAEARE 245

  Fly   140 WIEKSFHLDR-VDEALSVYELTSRLLCPMLTLYSLTGDSLYMDKAIHIADKILPAFDTPTGIPRR 203
            |:.|....|: ||  ::::|.|.|:|..:|:.|.||||:|::|||..|..:::|||.||:.||..
Zfish   246 WVAKELSFDKNVD--VNLFESTIRILGGLLSTYHLTGDNLFLDKAKEIGFRLMPAFSTPSKIPYS 308

  Fly   204 LV-VPKEGSTLTKYLSDISRTSEFGSLHLEFYYLSEVSGYPVYRERV-DAIREILAKTTRPNGLY 266
            .| :.|..:...::.|| |..:|..|:.|||..||.::|.|.|:..| :.::::.....:.:||.
Zfish   309 DVNIGKGTAHPPRWTSD-STVAEVTSIQLEFRELSRLTGDPKYKLAVMEVMKQVHKLDGKQDGLV 372

  Fly   267 PNAYCTKFGKWEN-----YNCSMHRLYDTLLKSWIQSGRTDTQNADTFKEAMLAVAQNLV-VINP 325
            |....|..|.:.:     ........|:.|||.|||.||.:.:..:.:.:|:..|.:||: ...|
Zfish   373 PMFINTNNGLFTHQGIYTLGARADSYYEYLLKQWIQGGRIEQELLEDYLQAVEGVKKNLLKKSTP 437

  Fly   326 EDVTYVSTFRNGTLFHRMRHSDCFAGGLFVLGAAETQMKHWEKYAHIGI---------GLTDTCH 381
            ..:|:|....:|....:|.|..||..|...||            .|.|:         .|.:||:
Zfish   438 LGLTFVGELSHGHFSPKMDHLVCFLPGTLALG------------VHYGLPADHMELAKQLIETCY 490

  Fly   382 DSYWSSPTRLGPDT--FAFTEESQQEIEPLQRNYYN-LRPEVAETYLVLWRITHHPQYRLWGLEM 443
            ..|....|.|.|:.  |...:.|.|:::....:.:| ||||..|:...|:|:|...:|:.||.|:
Zfish   491 QMYAQMETGLSPEIAHFNMHDGSTQDVDVKIADRHNLLRPETVESLFYLYRLTRDKKYQQWGWEI 555

  Fly   444 VQAIEKYCRMPYGYTGVMDVNNVT----SEPDDVQGSFFLGSTLKYLYLLFSDD-DVVSLEQWVF 503
            :|...||.|:|.|  |...:|||.    :.|.|...|||||.||||.|||||:| .::||:::||
Zfish   556 LQNFNKYTRVPTG--GYTSINNVRDPSYTSPRDKMESFFLGETLKYFYLLFSEDPTLISLDKYVF 618

  Fly   504 NSAGHFLPI 512
            |:..|.||:
Zfish   619 NTEAHPLPV 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Man-IcNP_733331.1 Glyco_hydro_47 78..512 CDD:279825 153/459 (33%)
man1b1bNP_001093449.1 Glyco_hydro_47 189..627 CDD:279825 153/459 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54359
OrthoDB 1 1.010 - - D263455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.