DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha-Man-Ic and Man1b1

DIOPT Version :9

Sequence 1:NP_733331.1 Gene:alpha-Man-Ic / 318624 FlyBaseID:FBgn0051202 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001102666.1 Gene:Man1b1 / 499751 RGDID:1563595 Length:657 Species:Rattus norvegicus


Alignment Length:509 Identity:158/509 - (31%)
Similarity:259/509 - (50%) Gaps:53/509 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TYIQCRAMMRESFQKNIPSN---DNSLKDM-----------NPDDMRAKIKEMMMHAWRNYARVV 90
            |.|..|..:.|..|...|.:   :.|:|.:           .|::.:..:.|..:|||:.|.:..
  Rat   162 TVISWRGAVIEPEQATEPPSKRAEASIKPLFLASRIWKEPAPPNERQKGVIEAFLHAWKGYQKFA 226

  Fly    91 WGTNEFRPISRRVH--FGGDFATYKLGATIIESLDTLHLMGLNKELRRSRDWIEKSFHLDR-VDE 152
            ||.:|.:|:|:...  ||       ||.|:|::|||:.::||.:|.:.:|.|:.::....: || 
  Rat   227 WGHDELKPVSKTFSEWFG-------LGLTLIDALDTMWILGLKQEFKEARKWVSENLDFQKNVD- 283

  Fly   153 ALSVYELTSRLLCPMLTLYSLTGDSLYMDKAIHIADKILPAFDTPTGIPRRLVVPKEGSTLTKYL 217
             ::::|.|.|:|..:|:.|.|:||||::.||....::::|||.||:.||...|....|...:...
  Rat   284 -VNLFESTIRILGGLLSAYHLSGDSLFLSKAEDFGNRLMPAFTTPSKIPYSDVNIGTGFAHSPQW 347

  Fly   218 SDISRTSEFGSLHLEFYYLSEVSGYPVYRERVDAI-REILAKTTRPNGLYPNAYCTKFGKWEN-- 279
            :..|..:|..|:.|||..||.::|...::|.|:.: :.|.:.:.:.:||.|....|..|.:.:  
  Rat   348 TSDSTVAEVTSIQLEFRELSRLTGIKKFQEAVEEVTKHIHSLSGKKDGLVPMFINTNSGLFTHPG 412

  Fly   280 ---YNCSMHRLYDTLLKSWIQSGRTDTQNADTFKEAMLAVAQNLV-VINPEDVTYVSTFRNGTLF 340
               ........|:.|||.|||.|:.:||..:.:..|:..:..:|: ...|..:|:|....:|...
  Rat   413 VFTLGARADSYYEYLLKQWIQGGKKETQLLEDYVRAIEGIKAHLLRQSQPRKLTFVGELAHGRFS 477

  Fly   341 HRMRHSDCFAGGLFVLGAAETQMKHWEKYAHIGI--GLTDTCHDSYWSSPTRLGPDTFAF----- 398
            .:|.|..||..|...||     :.|.....|:.:  .|.:||:.......|.|.|:...|     
  Rat   478 AKMDHLVCFLPGTLALG-----VHHGLPADHMDLARALMETCYQMNQQMETGLSPEIAHFNMYPR 537

  Fly   399 TEESQQEIEPLQRNYYNLRPEVAETYLVLWRITHHPQYRLWGLEMVQAIEKYCRMPYGYTGVMDV 463
            .:....|::|..|:.. ||||..|:...|:|:|...:|:.||.|::|:..||.|:|.|  |...:
  Rat   538 ADHKDVEVKPADRHNL-LRPETVESLFYLYRVTKDRKYQDWGWEILQSFNKYTRVPSG--GYSSI 599

  Fly   464 NNVTS----EPDDVQGSFFLGSTLKYLYLLFSDD-DVVSLEQWVFNSAGHFLPI 512
            |||.:    ||.|...|||:|.|||||||||||| :::.|:..|||:..|.|||
  Rat   600 NNVQNSHKPEPRDKMESFFVGETLKYLYLLFSDDLELLGLDTCVFNTEAHPLPI 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha-Man-IcNP_733331.1 Glyco_hydro_47 78..512 CDD:279825 146/455 (32%)
Man1b1NP_001102666.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..157
Glyco_hydro_47 214..653 CDD:279825 146/455 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54359
OrthoDB 1 1.010 - - D263455at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.