DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIE and grik5-like.1

DIOPT Version :9

Sequence 1:NP_001036733.1 Gene:GluRIIE / 318623 FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001072565.1 Gene:grik5-like.1 / 780020 XenbaseID:XB-GENE-5860197 Length:479 Species:Xenopus tropicalis


Alignment Length:441 Identity:148/441 - (33%)
Similarity:229/441 - (51%) Gaps:29/441 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 IILLSVPNKPYAQLVETYKQLEGNSQYEGYGVDLIKELADKLGFNFTF--VNGGNDYGSYNKSTN 485
            :.:.::..:|::...|        |..||:.:||:.|||..||||:|.  |..|. ||:.::..|
 Frog    43 LTVTTIMEQPFSMKTE--------SGMEGFCIDLLSELAQSLGFNYTIKEVKDGR-YGAKDQDGN 98

  Fly   486 ESTGMLREIMTGRADLAITDLTITSEREQALDFTIPFMNLGIAILYLKPQ-KATPELFTFMDPFS 549
            .: ||:.|::...||||:..||||..||:.|.||.|||..||:||..|.. .....||.|:.|||
 Frog    99 WN-GMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFS 162

  Fly   550 EEVWWFLGFSFLGVSLSFFILGRLSPSEWDNPYPCIEEPEELENQFTLGNSIWFTTGALLQQGSE 614
            :|.|..:..:::..||..|::|||||.||       .|....:|.|...||:||..||...||:|
 Frog   163 KETWIGILVAYVVTSLCLFLVGRLSPCEW-------TELSTEQNNFNFLNSLWFGVGAFTLQGAE 220

  Fly   615 IGPKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSL-INSVDDLADNKDGVVYGAKKTG 678
            ..||::|.|.:|..||.|::::|::|.|:.||||..:..|:. |.:.:||. |:..:.:|...:.
 Frog   221 PHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLV-NQRTLEFGTINSS 284

  Fly   679 STRNFFMTSAEERYKKMNKFMSE-NPQYLTEDNMEGVNRVKTNTHYAFLMESTSIEYNTKRECNL 742
            ||..||..|....|:.:.::|.: ..:.|.:...|||.||| .::||||.||...:....:.|:|
 Frog   285 STFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVK-ESNYAFLGESVMQDIMVAKHCDL 348

  Fly   743 KKIGDALDEKGYGIAMRKDWPHRGKFNNALLELQEQGVLEKMKNKWWNEVGTGICATKEDAPDAT 807
            .:....:..:|||||...|.|.....:.|:||..|.|.:|.::.|||:..    |..|..| ...
 Frog   349 VRAPQIIAGRGYGIAASLDSPLIKPLSVAILEQTESGNIEYLRKKWWDNT----CNMKRSA-GWN 408

  Fly   808 PLDMNNLEGVFFVLLVGSCCALLYGIISWVLFVMKKAHHYRVPLRDALKEE 858
            |:..:.|.|:|.:|.:|....::..::..||.....|...:.....|..||
 Frog   409 PVQPHTLGGIFLILGIGLALGVIAALVELVLKARNNADQQKKSCCSAFSEE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377
ANF_receptor 51..382 CDD:279440
PBP2_iGluR_Kainate 419..790 CDD:270432 132/371 (36%)
Lig_chan 551..824 CDD:278489 91/274 (33%)
grik5-like.1NP_001072565.1 PBP2_iGluR_non_NMDA_like 41..396 CDD:270403 132/371 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000021
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.