DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIE and Ir76a

DIOPT Version :9

Sequence 1:NP_001036733.1 Gene:GluRIIE / 318623 FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:383 Identity:79/383 - (20%)
Similarity:145/383 - (37%) Gaps:87/383 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 GMLREIMTGRADLAITDLTITSEREQALDFTIPFMNLGIAILYLKPQKATPELFTF---MDPFSE 550
            |::..|:..|.|..:..:.:..|..:.:|.|......|:..|...|.:    |.::   :.||..
  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR----LISWTLLLRPFQF 359

  Fly   551 EVWWFLGFSFLGVSLSFFILGRLSPSEWDNPYPCIEEPEELENQFTLGNSIWF---------TTG 606
            .:|..:....|..||:..|..|     |::            :....||| |.         |..
  Fly   360 VLWMCVMLCLLLESLALGITRR-----WEH------------SSVAAGNS-WISSLRFGCISTLK 406

  Fly   607 ALLQQGSEIGPKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNKDGVV 671
            ..:.|.:.....:.:.|||....:...:|:.:.|:..|||.||:...:...:|...|.|:|  ::
  Fly   407 LFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHK--LI 469

  Fly   672 YGAKKTGSTRNFFMTSAEERYKKMNKFMSENP-------QYLTEDNMEGVNRVKTNTH---YAFL 726
            :    || |...::|:.:||        |.:|       .|...|    .|.:...:|   ..|:
  Fly   470 W----TG-TSQAWITTIDER--------SADPVLLGLMEHYRVYD----ANLISAFSHTEQMGFV 517

  Fly   727 MESTSIEY--NTKRECN--LKKIGDALDEKGYGIAMR---KDWPHRGKFNNALLELQEQGVLEKM 784
            :|.....:  ||:...|  ||::...:|:..:...:.   :.|||...:|:.:|.....|.    
  Fly   518 VERLQFGHLGNTELIENDALKRLKLMVDDIYFAFTVAFVPRLWPHLNAYNDFILAWHSSGF---- 578

  Fly   785 KNKWWN----------EVGTGICATKEDAPDATP--LDMNNLEGVFFVLLVGSCCALL 830
             :|:|.          .....|.|:::...|..|  |.::|..|:..:...|..|:||
  Fly   579 -DKFWEWKIAAEYMNAHRQNRIVASEKTNLDIGPVKLGIDNFIGLILLWCFGMICSLL 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377
ANF_receptor 51..382 CDD:279440
PBP2_iGluR_Kainate 419..790 CDD:270432 67/329 (20%)
Lig_chan 551..824 CDD:278489 62/310 (20%)
Ir76aNP_001097647.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.