DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31198 and AC3.5

DIOPT Version :10

Sequence 1:NP_732654.1 Gene:CG31198 / 318622 FlyBaseID:FBgn0051198 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_001256214.1 Gene:AC3.5 / 179447 WormBaseID:WBGene00007071 Length:1090 Species:Caenorhabditis elegans


Alignment Length:274 Identity:57/274 - (20%)
Similarity:100/274 - (36%) Gaps:59/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 PSTAAPKLAIP-VPASLPARGPGRPSRAAASKHSAPPDLQYIVQSDDYFSTFAAGGKSVTSDHTL 359
            |....|:|..| :.::|...|..| .|......:|..:|..|...|:...|.::.|.::...|.:
 Worm     7 PDGHDPRLVGPRIESALEKSGQWR-CRRGPLFITAVGNLTQIPGGDESLRTLSSTGIALKHAHDI 70

  Fly   360 DRLQTPRLPQDVLLRLLEDTSGTNRAHAAAMQELLDDHSRQFARWLFLLD-QGYSVLLYGLGSKR 423
            .|            .|.|.|. .|.|.|..|........:..|..|:.:: :||.:||       
 Worm    71 QR------------DLFEWTD-ENLAPATIMLITSSKDLKTLASTLYDIEKKGYRILL------- 115

  Fly   424 TLLQSFHHRALADRPVLVVNG----FFPSLTV-----------KDVLDAVANDLLELQLPTALHH 473
                ::..||||.|..::.:.    |:.||..           :|:.....:.:..::||....:
 Worm   116 ----AYPPRALALRLSILKDVPEELFWDSLMADAAMEDNKQEQQDLFFRTTSAVKPVKLPCFAQN 176

  Fly   474 ETIDEIERELACQP------DLHVFLLVHN----LDGVAMRADRMQATLARLASLPNLHLVATID 528
            ..:  :.:.|...|      ::.:....||    ||...|...|.:|:..  .|.....|:.|.|
 Worm   177 AIL--VPKALKISPRISRVKNMRILEASHNNVDRLDPANMVLGRSKASFN--ISSQEWDLLVTQD 237

  Fly   529 ---HINAPLLWDAS 539
               |.::||...|:
 Worm   238 IAYHTSSPLTLKAT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31198NP_732654.1 M1_APN-Q_like 50..505 CDD:341064 47/235 (20%)
ERAP1_C 581..898 CDD:463368
AC3.5NP_001256214.1 GluZincin 165..651 CDD:472708 19/91 (21%)
beta-trefoil_FSCN-like <685..741 CDD:483951
ERAP1_C 728..1056 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.