DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31198 and Rnpepl1

DIOPT Version :9

Sequence 1:NP_732654.1 Gene:CG31198 / 318622 FlyBaseID:FBgn0051198 Length:940 Species:Drosophila melanogaster
Sequence 2:NP_852070.3 Gene:Rnpepl1 / 108657 MGIID:1914170 Length:720 Species:Mus musculus


Alignment Length:453 Identity:110/453 - (24%)
Similarity:189/453 - (41%) Gaps:88/453 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 RRAFPSFDEPQFKATFDVTLKRHRTFNSVSNTRLISSYPST---EEGIFSDVYKTTPKMSTYLLA 249
            |..||.||.|..|.|:...:|.     .:....|:|:..|.   |||::.  :.....:..||:|
Mouse   198 RSFFPCFDTPAVKCTYSAVVKA-----PLGVQVLMSATQSVYVEEEGLYH--FHMEHPVPAYLVA 255

  Fly   250 FIISEFVARKDDDFG----VYARPEYYAQTQYPYNVGIQILEEMGQYL---DKDY--YSMGNDKM 305
            .:..:.   |..|.|    |:|.|..........:..::      |:|   ::.|  |..|  :.
Mouse   256 LVAGDL---KPADIGPRSRVWAEPCLLPTATSKLSGAVE------QWLSAAERLYGPYMWG--RY 309

  Fly   306 DMAAI-PDFSAGAMENWGLLTYRERSLLVDESATTLASRQSIAAVVAHEQAHMWFGDLVTCKWWS 369
            |:..: |.|...|||| ..||:...|:        |.|.:.:...|.||.||.|||:.||...|.
Mouse   310 DIVFLPPSFPIVAMEN-PCLTFIISSI--------LESDEFLVIDVIHEVAHSWFGNAVTNATWE 365

  Fly   370 YTWLNEGFARYFQ------YFGTAMVEDKWELEKQFVVDQVQSVMAM---DSTNATNPLSDENTY 425
            ..||:||.|.|.|      .:|.|..    .||..|.:|.:...|.:   ||..:...:..|...
Mouse   366 EMWLSEGLATYAQRRITTETYGAAFT----CLETAFRLDALHRQMRLLGEDSPVSKLQVKLEPGV 426

  Fly   426 TPAHLSRMFNSISYNKGATFIRMIKHTM-GEQQFQKSLQEYLKKYEYQSSLPEYLLGAWQANWPN 489
            .|:||..:|   :|.||..|:..:.... |.|:|...|:.|::||::.|.:.:.||.::.:.:| 
Mouse   427 NPSHLMNLF---TYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFP- 487

  Fly   490 SSYNESSKDI-----FKSFTEQVGYPLI--NVTVGNSQVSFTQKRFL------LKESDGSDSSLK 541
             ...|.|.|.     |:.:....|.||.  :::.|:|.....:..|.      |:::..|.|::.
Mouse   488 -ELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPLEQAAASASAID 551

  Fly   542 YTVPISYTTSETNNFL------NTTPKFILK------PNVTTTVQFNSTIKWIVVNIQQTGYY 592
            .:   .:.|.:|..||      :..|:.::.      .::..::.....|:|:.: :.:..||
Mouse   552 IS---KWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQI-VVRNDYY 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31198NP_732654.1 Peptidase_M1 42..442 CDD:279741 74/275 (27%)
M1_APN_2 50..510 CDD:189008 93/349 (27%)
ERAP1_C 582..898 CDD:288671 2/11 (18%)
Rnpepl1NP_852070.3 M1_LTA4H 29..507 CDD:189006 92/344 (27%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P15144 321..325 2/3 (67%)
Leuk-A4-hydro_C 524..668 CDD:312599 13/91 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.